PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011086813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 469aa    MW: 51161.2 Da    PI: 7.6108
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011086813.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.16.7e-40182259178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +C vegC+ dls+akeyhr+h+vC+ hsk+p+v+v gle+rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+++
  XP_011086813.1 182 RCVVEGCNIDLSTAKEYHRKHRVCDSHSKCPKVVVGGLERRFCQQCSRFHTLSEFDEKKRSCRRRLSDHNARRRKPHQ 259
                     6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-33179244IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.188180257IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.09E-37181262IPR004333Transcription factor, SBP-box
PfamPF031102.6E-30183256IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MSHFAEMEWN SKWDWENFLG FGSKAIESPK KLQLADWTIV DDGQIDAGSF NLSAGGGNSG  60
ASDSDGGHVS SAKSSISAST DSSTKDGMQN PNFGLITFQG FSGNFSKKME MEGADVSGTS  120
PLMDASIGSV EPLIGLKLGK RTYFENSGAG GNVKTAPLSA MPTPATSLKK TKSLGQNLPI  180
PRCVVEGCNI DLSTAKEYHR KHRVCDSHSK CPKVVVGGLE RRFCQQCSRF HTLSEFDEKK  240
RSCRRRLSDH NARRRKPHQE AIQFNSTRLS SPFYEARQQI SFLLNNAPLI HSRNPANTTW  300
DGASNSKFTL TKGYHFKSNG DGGTDEQMHM PGINLPHAID MHGTAANDFL VSKSSIPTVL  360
DPGSKGPLMS SHLDAAPEYR CALSLLSSNS WSSCGPELMP VNNQMDELGT SVDQRMMHAT  420
PEGVPLSSSQ FWLTGHQPTQ PRVATNGNFQ EVQLLKTPYE ADFYSNILN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-281832561184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1238255KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086813.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A022R3T10.0A0A022R3T1_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000847341e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-63squamosa promoter binding protein-like 2